PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012571788.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MYB_related
Protein Properties Length: 519aa    MW: 59263.1 Da    PI: 5.8364
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012571788.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.84.6e-12107149346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       W+++E+ ll++a++++G g+W+ +a ++g ++   qc++++++
   XP_012571788.1 107 DWSADEERLLLEAIEMYGFGHWNDVADYVG-TKGKPQCIDHYND 149
                      6*****************************.999999*****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250242.5E-12635504IPR016827Transcriptional adaptor 2
SMARTSM002911.5E-94489IPR000433Zinc finger, ZZ-type
SuperFamilySSF578501.53E-1548111No hitNo description
PROSITE profilePS5013510.6324891IPR000433Zinc finger, ZZ-type
CDDcd023356.68E-264896No hitNo description
PfamPF005692.6E-94888IPR000433Zinc finger, ZZ-type
PROSITE patternPS0135705077IPR000433Zinc finger, ZZ-type
SuperFamilySSF466895.53E-12100154IPR009057Homeodomain-like
PROSITE profilePS5129319.777103155IPR017884SANT domain
SMARTSM007174.9E-10104153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-7107150IPR009057Homeodomain-like
PfamPF002492.0E-11107149IPR001005SANT/Myb domain
CDDcd001677.47E-10108148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009409Biological Processresponse to cold
GO:0016573Biological Processhistone acetylation
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MGRCRTASRS SDDDPNQRSK RKRAALYAEN LETSSTGLGI TEGKASLYHC NYCNKDISGK  60
IRIKCVVCQD FDLCIECFSV GAEVTPHKSN HPYRVMDNLS FPLTSPDWSA DEERLLLEAI  120
EMYGFGHWND VADYVGTKGK PQCIDHYNDV YMNSPCFPLP DLSHVMGKSK EELLAMAKGH  180
QVNREFPPKA ELTLKEEPLM SDGINSEESK KEEATNQTMS RLTSVCDKAL SSTIKKASNV  240
SQNNDRVKVE ESQADRSIGE KKPKFSGEDR SYMKELRGYN FKRGEFDIEY DNDAEQVLAE  300
MEFKDTDTEA EHEMKLQVLR IYSKRLDERK RRKNFILERD LLCPDPFEKS LSPEELQICQ  360
PYKVFMRFHS KEEHEELLKT VIEEHRLVKR IQDLQEARIA GCVTAVEAYR FIEQKKTKEA  420
EQGACKESGL IGTSVKTLQR PIYPKIELGS SPRGLHKGTT ASFAGIKDTH TAIQAITRSL  480
EEWDISDFEG AELLSESVRN FSLVFFSSSF VIFMLLFLY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0248802e-98CU024880.19 M.truncatula DNA sequence from clone MTH2-7H19 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012571788.10.0PREDICTED: transcriptional adapter ADA2
SwissprotQ75LL61e-175TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLK7LYC10.0K7LYC1_SOYBN; Uncharacterized protein
STRINGGLYMA13G11200.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726